PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_025947
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family ZF-HD
Protein Properties Length: 314aa    MW: 35002.8 Da    PI: 7.2517
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_025947genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.92.2e-3295149358
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                  +++Y+eClkNhAas+Ggh+vDGCgEfmps geegt++a+kCaAC+CHRnFHRre e
  DCAR_025947  95 RCQYRECLKNHAASIGGHVVDGCGEFMPS-GEEGTPEAFKCAACECHRNFHRREAE 149
                  689*************************9.999********************987 PP

2Homeobox17.57e-06249309157
                  TT--SS--HHHHHHHHHHHH....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
     Homeobox   1 rrkRttftkeqleeLeelFe....knrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                  +r Rt+ftkeq +++ e+ e    k ++ + ee ++L ++lg++ ++ kvW +N ++ +kk
  DCAR_025947 249 KRFRTKFTKEQKDRMHEVAEkmgwKIQKQDDEEVQQLCQELGVKRQVFKVWMHNNKQAMKK 309
                  789*************9999666668999****************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-2088150IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047709.8E-3096148IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.8E-3097147IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.34898147IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466893.19E-20236309IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-30240310IPR009057Homeodomain-like
PROSITE profilePS500719.961246310IPR001356Homeobox domain
TIGRFAMsTIGR015654.3E-26248305IPR006455Homeodomain, ZF-HD class
CDDcd000869.21E-5249311No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MEGLQSSLDF TSNSTQPNQD SSAPKLPSGQ TLDQFRQFYV HQHQRPEPTQ PDPDPDTIPD  60
PDPPQLGAAT SGAPNSSTPP AQLPRQEPEV ASPVRCQYRE CLKNHAASIG GHVVDGCGEF  120
MPSGEEGTPE AFKCAACECH RNFHRREAEG GESRQFATPN VYYPHNPNGI NINSLRNANH  180
QSQILPTRHQ HRHFPNHFSH SLASPTGPVM MAFGGRGPEE SSSEDLNMFQ SPGGGQHMGL  240
PSSYSGSKKR FRTKFTKEQK DRMHEVAEKM GWKIQKQDDE EVQQLCQELG VKRQVFKVWM  300
HNNKQAMKKK QDQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A2e-212483041773ZF-HD homeobox family protein
1wh7_A2e-212473041673ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099626.11e-87PREDICTED: zinc-finger homeodomain protein 6
SwissprotQ9ZPW71e-64ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A068U3229e-88A0A068U322_COFCA; Uncharacterized protein
STRINGPOPTR_0005s12420.12e-80(Populus trichocarpa)
STRINGPOPTR_0007s12970.12e-80(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.12e-65homeobox protein 24